Organizational Policy and Strategy Case Study Example | Topics and Well Written Essays - 1000 words - 1

Organizational Policy and Strategy - Case Study Example The industry rivalry amongst the producer businesses is important criteria for introducing cutting edge differentiating element in the products to gain leverage. This is one of the major motivating factors for Samsung Inc to be highly innovative in its products and development processes. The quality and creative input within the product gives huge advantage to the suppliers and puts him in a bargaining position. Samsung producing high quality memory chips at relatively low cost has been able to bargain with its customers. The bargaining power of buyers is reduced when there is short supply of quality goods which have great demand. In the case of Samsung, the buyers increasingly prefer them because of their quality products and their credibility of supplying goods timely. The technological advancements have brought forth an explosion of information that is easily accessible to public through the internet and other media like television, radio, mobile phones etc. The competition from substitute become highly likely and the company needs to adopt innovative approach to its marketing. Samsung has successfully met this aspect by evolving flexible strategies like innovative product like and introducing elements of surprise within the products as well within the marketing of the products and services. Last but not the least is the threat from new entrants of the business. The globalization has provided facilitating grounds for new entrants and therefore, the existing firms must ensure that speed and flexibility become intrinsic part of their strategy as they become extremely important ingredients for the products so that the organizations can timely and efficiently meet the fast changing preferences of the customers. Under the dynamic leadership of Kun Hee Lee, the company enjoyed competitive advantage over their rivals in the world market primarily because of the sharp business

Credit Card Fraud Detection through Data Mining

Credit Card Fraud Detection through Data Mining Abstract With the increasing fraudsters day to day, the fallacious transaction is rapidly growing thus making the frauds in this scenario a matter of high importance. Huge database patterns are identified by various data mining models assisting to strengthen and detect the credit card fraud. This research primarily focusses on Credit Card Fraud Detection analyzing two different methods used to detect fraudulent systems and implement the new technologies to the system to minimize frauds in credit card transactions Keywords- Data Mining, Methods, Credit Card, Fraud Detection, Hybrid Technology, Neural Network, Support Vector System Data Mining is filled with application growth opportunities and research which are reliable and usable from the data. Rapid development of e-commerce, usage of credit card has become well known mode for online and regular transactions, increasing the credit card fraud simultaneously. Fraud detection is a complicated problem as unwanted transactions are hidden in the authoriosed transaction. Due to security reasons and also to gain trust of users credit card fraud detection has now become important to companies. Neural Networks [1], Bayesian Network [2], Hidden NaÃÆ' ¯ve Bayes Network [12], Dempster Shafer [10] are few methods to be justified in detecting the credit card fraudulent system. With the new technologies, it has now become easy for the companies and banks to detect the fraudulent system. With the growing credit card fraud problem in the industry this literature review will help us to understand and detect the techniques involved in detecting the fraudulent system. We will be describing two different approaches Neural Network and Support vector machine approach thus learning a new method to minimize the fraudulent system. This paper helps us to analyze data mining methods with respect to credit card fraud system. A. Neural Network Approach Neural network fraud detection method is primarily based on working of a human brain. Just as the human brain is capable of learning things from the previous experiences and uses the knowledge to decide things occurring in day to day problems the same strategy is used while detecting a credit card fraud with Neural Network system. Neural Network can reflect a small part of complexity and regulation Banks use this kind of network method to detect the credit card fraud. The moment a transaction takes place there are a set of attributes attached to it characterizing the account holder, the amount and the merchant. Considering an example, for the Mellow Bank Fraud Detection Feasibility Study a particular archived amount of data was used for model development as the authorized data wasnt easily available due to security reasons. P-RCE [3] neural network technique is used. P-RCE is used for pattern recognition as it helps to describe what exactly the human brain is thinking about. P-RCE has a single cell layer which outputs a numeric response called as Fraud score. The lower the threshold the more no. of credit card fraud is detected. Higher the credit card detection threshold less no. of fraud is detected. With 2000000 transactions of Mellon Banks data from Oct-Nov 1991, nearly measuring 50 accounts per day 40% of the fraudulent transaction was observed but prior to use of P-RCE method in Mellon Banks feasibility study the result came out to be 1 fraudulent transaction per week on reviewing 750 account per day. The improvement in the fraud detection performance was undeniably considerable. The p attern recognition method can actually help the banks to reduce 20-40% (in total) credit card fraud losses. B. Support Virtual Machine Approach An online transaction has four entities: credit card holder, credit card, the seller and the buyer. There is an independent history of transactions with each set of entities in the data set. Each entity keeps almost a consistent behavior pattern in authorized transactions. The risk of a transaction can be estimated by calculating the inconsistency of a transaction from the history of authorized transactions. Let us define Xe(t) {a1, a2, à ¢Ã¢â€š ¬Ã‚ ¦, an) as the transactional set in the entitys history is equivalent to f(t) beingF(t) {seller, buyer, holder, card) set of entities. We calculate the score of transactions, by defining l = (l1 , l19) [3] with c as value of a feature, as SC(l,e,t) = count(c,Xe(t)) The idea to calculate how near a transaction is related to past authorized transactions therefore we consider only those transactions that are proved legitimate from Xe(t). To train and test a classifier (weight and score) we have a vector in conjunction with the classification: SVM (Support Vector Machines). They are essentially supervised learning models used for analyzing data and recognition of patterns. Using the traditional methods, raw data was classified with SVM to check the impact of general weight in the outcomes and reduce SVM complexity as well. SVM classifier was used in classifying the transactions as fraud or authorized resulting in 40-50% in most months with false alarm rate 10-12%. The online credit card fraud system can be detected and improvised with the Big Data Technologies framework. The main aim is to achieve the goal of fusing various detection methods to enhance the accuracy. A workflow was proposed [13] containing common designs of fraudulent system thus making it easier to integrate identification of fraud system. In recent years, big data platforms were released to process and operate data including MapReduce and Apache Hadoop frameworks (open source for MapReduce). Two components are primarily considered: spouts and bolts. The source of streams is referred to as spout which reads and sends tuples from external source into topology. The data processing is done by Bolt. With the reference, the paper proposes a hybrid structure with Big data efficient in solving challenges related to performance and integration. The basic workflow is defined [13] in the figure. QF- Quick filter, DSA Demper Shafer Adder (combining different fraud scores and generating a merged result), EF- Explicit filter. This workflow is designed by combining different algorithms together for a higher accuracy like two DSAs are combined so that we can aggregate their fraud score to get better accuracy; 2) Another aspect can be considered by combining supervised unsupervised fraud approaches to examine a good cover of types of fraud; 3) The filters used: QF detects only the behavior of card holder whereas EF detects the historical data in the whole model. So, to achieve faster filter we can combine QF and EF as well as to get better efficiency the combination is good to go. In this paper, we have reviewed two data mining detection methods of credit card fraud. The research papers which arent considered here might have comprehensive methods to research and implementations of new detection techniques. This research paper describes: The Neural Network can be implemented in banks to reduce the credit card fraudulent system with it P-RCE algorithm. 2) Support Vector machine can detect the frauds in ecommerce system real time but isnt much reliable for complex frauds. 3) Hybrid technology framework, the workflow is essential to detect frauds in offline system as the method but can improve accuracy, performance and efficiency. To develop a credit card fraud system, the neural network method is best suited according to my understanding as it is efficient, accurate and cost effective thus implemented in Mellon Bank. Neural Network method has some failures as well but gradually with new technology it can overcome. But to develop a strong fraud detection system using credit card we need to combine few more complex detecting methods. References [1] S. Ghosh and D. L. Reilly, Credit card fraud detection with a neural network, in System Sciences, 1994. Proceedings of the Twenty-Seventh Hawaii International Conference on, vol. 3, Jan 1994, pp. 621-630. [2] G. F. Cooper and E. Herskovits. A Bayesian Method for the Induction of Probabilistic Networks from Data. Machine Learning, 9(4):309-347, 1992. Santiago, Gabriel Preti, Adriano Pereira, and Roberto Hirata Jr. A modeling approach for credit card fraud detection in electronic payment services. In Proceedings of the 30th Annual ACM Symposium on Applied Computing, pp. 2328-2331. ACM, 2015. Online Credit Card Fraud Detection: A Hybrid Framework with Big Data Technologies You Daià ¢Ã‹â€ -, Jin Yanà ¢Ã‹â€ -, Xiaoxin Tangà ¢Ã‹â€ -, Han Zhaoà ¢Ã¢â€š ¬Ã‚   and Minyi Guoà ¢Ã‹â€ - à ¢Ã‹â€ -Department of Computer Science and Engineering, Shanghai Jiao Tong University, China à ¢Ã¢â€š ¬Ã‚  School of Computer Science Technology, Huazhong University of Science and Technology, China Philip K. Chan, Wei Fan, Andreas 1. Prodromidir, and Salvotore 1. Stalfo, Distributed Data Mining in Credit Card Fraud Detection 2016 IEEE TrustCom/BigDataSE/ISPA H. Michael Chung Fredric C. Gey Data Mining, Knowledge Discovery, and Information Retrieval, Proceedings of the 34th Hawaii International Conference on System Sciences 2001 Agrawal, Ayushi, Shiv Kumar, and Amit Kumar Mishra. Implementation of Novel Approach for Credit Card Fraud Detection. In Computing for Sustainable Global Development (INDIACom), 2015 2nd International Conference on, pp. 1-4. IEEE, 2015. [2008] Abhinav Srivastava, Amlan Kundu, Shamik Sural and Arun K. Majumdar, CreditCard Fraud Detection Using Hidden Markov Model IEEE, Transactions on Dependable and Secure Computing, Vol. 5, No 1., January-March D. L. Reilly and L. N. Cooper, An overview ofneural networks: early models to real worldsystems, in An Introduction to Neural and Electronic Networks, ed. S. F. Zometzer, J. L. Davis and C. Lau, 227-248, Academic Press, (1990). S. Panigrahi, A. Kundu, S. Sural, and A. Majumdar, Credit card fraud detection: A fusion approach using dempstershafer theory and Bayesian learning, Information Fusion, vol. 10, no. 4, pp. 354 363, 2009. Z. D. Zhao and M. s. Shang, User-based collaborative-filtering recommendation algorithms on hadoop, in Knowledge Discovery and Data Mining, 2010. WKDD 10. Third International Conference on, Jan 2010,pp. 478-481. [12] Jiang, Liangxiao, Harry Zhang, and Zhihua Cai. A novel Bayes model: Hidden naive Bayes. IEEE Transactions on knowledge and data engineering 21, no. 10 (2009): 1361-1371. [13] Dai, You, Jin Yan, Xiaoxin Tang, Han Zhao, and Minyi Guo. Online Credit Card Fraud Detection: A Hybrid Framework with Big Data Technologies. In Trustcom/BigDataSE/Ià ¢Ã¢â€š ¬Ã¢â‚¬ ¹ SPA, 2016 IEEE, pp. 1644-1651.IEEE, 2016.

The Effects of Environmental Policy on the Italian Economy, and Population :: Environment Italy Ecology Essays Papers

The Effects of Environmental Policy on the Italian Economy, and Population Introduction. The history of Italy is storied with rich traditions of emperors conquering land and building great empires. The culture of this great time period can still be enjoyed in the many infamous artworks and architectural masterpieces to this day. The pride of the Italian people can be seen in the many expert craftsmanship works in addition to boasting the sixth largest economy in the world. The balance of preserving the many priceless artworks of ages gone by with the byproduct of current economic expansion bodes a challenge to the environmental policies agreed upon by the Italian people. In my paper I will talk about the many aspects of how environmental policies impacts the population, economy and Italy’s natural resources. First I will provide background knowledge of the Italian people then I relate environmental topics such as air pollution, population trends and water management to one another. These topics are relevant to this course because they relate population and economics to the environment. Italy is a nation of 56, 735,130 million people strong www.expage.com/page/rozitaly2. One aspect of the new global Italian economy is driven by the artisanship and entrepreneurship of its people. The craftsmanship is renowned worldwide and one specific example of that was when the New York Financial Center was built, Italian marble and its stonemasons were explicitly used. Italians also are generally more business minded with the household savings rate of Italians shown to 3 average 18.3%; almost three times higher than of Americans. Also over 85% of Italians own two or more homes. Although differences are apparent between the north and south regions as many Italians live significantly better in the north region. Italy like many other nations is driven by capitalistic efforts to maximize profits and capital. www.floriapublications. com/italy/life One of the interesting differences about Italy compared to other various countries is the way government and its people perceive one another. As money is a main component in global markets, Italy crisis over tax obligations remain high. Up to recently higher taxes top the income rate of 51% and the public debt amounts to 124% of the GNP. Higher employment rates around 11% are misleading due to the large amount of so-called black market and under the table paid by cash only workers. Social security taxes are seldom reported and pension problems do exist. The lack of reporting or no reporting can supposedly add 19% of the value –added taxes go uncollected and unnoticed. The police largely look the other way and known black markets go on. The role of money is the fuel that drives the goods and services being bought and sold in the

African American Essay

Write a 750- to 1,400-word paper in which you consider the following regarding the religious group and racial/ethnic group you selected: Religious group:Â  How does your selected religious group differ from other religious groups (such as in their beliefs, worship practices, or values)? What has been the experience of your selected religious group with others that do not share its beliefs or practices? In what ways has the religious group you selected contributed to American culture? Provide specific examples of prejudice or discrimination your selected religious group has experienced. What were the sources of this prejudice or discrimination? Does what you’ve learned about this religious group help you understand it? In what ways? Racial/ethnic group: How does your selected racial/ethnic group differ from other racial/ethnic groups (such as differences in ancestry, language, or culture)? What has been your selected group’s experience with other groups? In what ways has the racial/ethnic group you selected contributed to American culture? Identify some specific examples of prejudice or discrimination that your selected group has experienced historically. What were the sources of this prejudice or discrimination? Does what you’ve learned about this racial/ethnic group help you understand it? How? Include the following as part of your conclusion: How are the prejudice and discrimination experienced by your selected religious group and racial/ethnic group similar? How are they different? Can you draw any conclusions about discrimination from this comparison? Provide citations for all the sources you use.

Media Coverage and the Right to a Fair Trial

In her written statement last November 9 2005, Barbara E. Bergman, the President of the National Association of Criminal Defense Lawyers, aptly stated in behalf of the NACDL that the fundamental issue of every criminal trial is not to entertain, nor to educate, but to administer justice[1].The controversy regarding whether media coverage of criminal trials is detrimental to a fair trial or not is hotly debated and difficult to balance. Even high caliber lawyers have not reached a general consensus about the issue. The tension between the pros and cons of the said subject is still being balanced every time process of litigation is on going. Questions arising from this issue involved: How much of the media be allowed? Will it be helpful to let the media cover every trial of a particular case from start to finish?What about the parties involved? Does decision to permit the media or not be the sole right of the judge, or is it the right of all the parties involved, including the defendan t? These are but â€Å"some† of the important components that embody the whole subject. The apprehension is that, too much publicity might affect the trial’s fairness. The unrestrained freedom given might be used or manipulated to influence fair and just decisions on the parts of the jury and the judge.This paper covers the different views pertaining to media coverage/publicity of a trial. What are the advantages and disadvantages when media coverage is allowed? What are the effects – negative or positive – of the media to a fair trial?The Pros of PublicityArguments for media coverage inside the courtroom are solid and convincing. As cited by Bergman in her written testimony, it promotes â€Å"civic awareness† raises â€Å"government accountability,† and enhances â€Å"legal professionalism†[2]. Bergman was right when she pointed these three positive results of opening the court to the public via media reporting. A prying press, in th is case, has become and is indeed a friend and complimentary to the justice system. It exposes everything. When there is malpractice on the side of the police, the prosecutors, and the judges, the media is supportive and contributory in the exacting of fairness to the opposite side[3].It is also appeasing to the public, especially when a particular case is controversial – involving celebrities or notorious personalities. The public whose curiosity have made them a part of the trial must be given the chance to participate, or else, mistrust to jurisprudence will take place among people in general, as a result. Media coverage is of great assistance in this area.It prevents closed door proceedings and subjects people of authority to the scrutiny of the public and thus avoid further corruptions which could otherwise happen when media is banned from the deliberations. Another plus of the coverage of criminal trials is that it promotes respect to the justice system. It alleviates t he mystery of secrecy in closed insulated proceedings. When there is no care on the part of those involved in executing justice inside hearings and open trial is rather encouraged, public trust heightens, and thus deference to whatever outcomes – may it be comporting to the general sentiment of the public or not.Because there is also that â€Å"damning stigma† to the so-called pretrial publicity (an irony inherent to media coverage), open trial dispels this. The consequent result that oftentimes reverses the guilty verdict of the public restores the already smeared reputation of the criminal defendant. When charges are dismissed, and the premature guilty judgment is eventually proven wrong, the supposed criminal is vindicated before the watching community.Last point in favor of media involvement, is the benefit that the government, the people, and jurisprudence itself, obtain in this process. Insights to the already wisely crafted laws are contemplated and possible or potential modification of existing laws is considered. As Barbara E. Bergman has stated in her testimony, â€Å"Court TV must be credited for its considerable contributions in all of these areas†[4].The Cons of Media CoverageThe arguments against media involvement in judicial processes are equally convincing. There are also disadvantages to unrestrained media meddling. One primary concern is its negative effects to the parties involved in a particular litigation. The conspicuous presence of cameras inside the courtroom will affect the behaviors of the â€Å"main players† of a specific case.It will thus weaken the procedure or the â€Å"fair administration of justice†[5]. Because lawyers, defendants, jurors, and judges, and witnesses are aware that they are being watched, in this kind of scenario, their tendency is to act unnaturally; in other words, they may act hypocritically, and this will be to the detriment of fair judicial process. In the O.J. Simpson case, there were instances when crucial witnesses withheld their testimonies because of fear that they are being watched by the public[6].If the jurors had been made aware beforehand that the case they were handling would be televised and publicized, the overall verdict would definitely be affected. Concern for the public’s opinion of whatever the eventual decisions they will ever come up regarding the future of the defendant, will or may get into the deliberations process.ConclusionThe important thing in the whole scenario of judicial procedures everywhere is striking a balance between the pros and the cons of media involvement. First, of course is the fairness that begins in whose authority it is to say â€Å"yes† or â€Å"no† to the media. As the NACDL has forged and is now binding in the courts of America, all parties involved in the case – Judge, Prosecutors, Defendants, etc. – have to be asked. Everyone must be given the freedom to exercise his/he r right. Is it true that, because the eyes of the general public are watching a particular case, it thus precludes a fair trial?Does presence of cameras in the court demean and disrupt the proceedings? Are the participants in the hearing process – judges, attorneys, jurors, and witnesses – get affected negatively, and therefore adjust their behavior because they are conscious that they are being watched? No one knows for sure whether these are true or not. They may be in many cases, and again, maybe not. The important thing is to strike a balance in both sides and apply what is necessary to secure due process of law. Remember, the fundamental issue in every criminal trial is the administration of justice, not entertainment nor to educate.Works CitedBergman, Barbara. 2005. Cameras in the Courtroom. National Association of Defense Criminal Lawyers accessed on April 28, 2007 in. http://judiciary.senate.gov/testimony.cfm?id=1672&wit_id=4801.Goldfarb, Ronald. The Trial of t he Century Accessed on April 28, 2007I Reiner, â€Å"Cameras Keep Justice System in Focus,† The National Law Journal, October 23, 1995, p. A23. in Goldfarb, Ronald. The Trial of the Century Accessed on April 28, 2007Cameras in the Courtroom. 2005 National Association of Defense Criminal Lawyers in   http://judiciary.senate.gov/testimony.cfm?id=1672&wit_id=4801.Ibid. Goldfarb, Ronald. The Trial of the Century. Accessed in http://www.cosmos-club.org/web/journals/1998/goldfarb.html http://judiciary.senate.gov/testimony.cfm?id=1672&wit_id=4801. Ibid. I Reiner, â€Å"Cameras Keep Justice System in Focus,† The National Law Journal, October 23, 1995, p. A23. in Goldfarb, Ronald. The Trial of the Century Accessed on April 28, 2007 in http://www.cosmos-club.org/web/journals/1998/goldfarb.htmlhttp://www.cosmos-club.org/web/journals/1998/goldfarb.html.   

Free Essays on Zimmermann

Between 1914 and the spring of 1917, the European nations engaged in a conflict that became known as World War I. While armies moved across the face of Europe, the United States remained neutral. In 1916 Woodrow Wilson was elected President for a second term, largely because of the slogan "He kept us out of war." Events in early 1917 would change that hope. In frustration over the effective British naval blockade, in February Germany broke its pledge to limit submarine warfare. In response to the breaking of the Sussex pledge, the United States severed diplomatic relations with Germany. In January of 1917, British cryptographers deciphered a telegram from German Foreign Minister Arthur Zimmermann to the German Minister to Mexico, von Eckhardt, offering United States territory to Mexico in return for joining the German cause. This message helped draw the United States into the war and thus changed the course of history. The telegram had such an impact on American opinion that, according to David Kahn, author of The Codebreakers, "No other single cryptanalysis has had such enormous consequences." It is his opinion that "never before or since has so much turned upon the solution of a secret message." In an effort to protect their intelligence from detection and to capitalize on growing anti-German sentiment in the United States, the British waited until February 24 to present the telegram to Woodrow Wilson. The American press published news of the telegram on March 1. On April 6, 1917, the United States Congress formally declared war on Germany and its allies. The story of British intelligence efforts to decipher the German code is fascinating and complicated. The Zimmermann Telegram by Barbara Tuchman recounts that story in all of its exciting detail. It is an excellent historical account for high school students.... Free Essays on Zimmermann Free Essays on Zimmermann Between 1914 and the spring of 1917, the European nations engaged in a conflict that became known as World War I. While armies moved across the face of Europe, the United States remained neutral. In 1916 Woodrow Wilson was elected President for a second term, largely because of the slogan "He kept us out of war." Events in early 1917 would change that hope. In frustration over the effective British naval blockade, in February Germany broke its pledge to limit submarine warfare. In response to the breaking of the Sussex pledge, the United States severed diplomatic relations with Germany. In January of 1917, British cryptographers deciphered a telegram from German Foreign Minister Arthur Zimmermann to the German Minister to Mexico, von Eckhardt, offering United States territory to Mexico in return for joining the German cause. This message helped draw the United States into the war and thus changed the course of history. The telegram had such an impact on American opinion that, according to David Kahn, author of The Codebreakers, "No other single cryptanalysis has had such enormous consequences." It is his opinion that "never before or since has so much turned upon the solution of a secret message." In an effort to protect their intelligence from detection and to capitalize on growing anti-German sentiment in the United States, the British waited until February 24 to present the telegram to Woodrow Wilson. The American press published news of the telegram on March 1. On April 6, 1917, the United States Congress formally declared war on Germany and its allies. The story of British intelligence efforts to decipher the German code is fascinating and complicated. The Zimmermann Telegram by Barbara Tuchman recounts that story in all of its exciting detail. It is an excellent historical account for high school students....

5-Paragraph Essay on Abraham Lincoln

5-Paragraph Essay on Abraham Lincoln 5-Paragraph Essay on Abraham Lincoln Abraham Lincoln, the 16th president of the United States, was born on February 12, 1809 and died at the age of 56 on the 4th day of March 1861. Lincoln was the president of the United States for four years from 1861 to 1865. Lincoln was born in Hardin County in the state of Kentucky in a small cabin that only had one room. His parents, Thomas Lincoln and Nancy Hanks were farmers who had a large track of land that measured 348 acres on which their cabin was situated. His parents were uneducated, however. Lincoln’s political career began in 1832 when he created a political campaign for a political party known as the Whig Party. This party was based on efforts that sought to improve navigation on the neighboring river. Ten years later, Lincoln married the love of his life, Mary Todd, with whom he had four sons. Unfortunately, only one of his four sons did not survive into adulthood. Lincoln’s participation in active national politics took a turn for the better in 1842 when he campaigned and was elected to the US House of Representatives. While at the House of Representatives, Lincoln accomplished a number of things including accrediting the American-Mexican war to then president, Polk. Lincoln was, however, not a popular figure with the democrats, due to his speeches that tended to go against the beliefs of the Democratic Party. In 1960, Lincoln’s political star had grown so much such that he was nominated by the Republican Party to become their presidential candidate. His temperate views on the issues of western origin and slavery are said to have significantly contributed to his preference as a Republican candidate. Throughout the election period, Lincoln did not give any speeches but instead gave the Republican organization charge of any speeches that were required. On the 6th day of November 1860, Lincoln assumed the highest office in the US when he was elected to the office of the president of the land. It was during Lincoln’s presidency that the Civil War began. This war began in the year 1861 and ended up consuming a large portion of Lincoln’s time as the president of America. Biographies of Lincoln report that Lincoln often found himself very frustrated by the events that were taking place in the war. The war eventually ended on the 9th day of April 1865 when Robert Lee decided to surrender in Virginia. The 14th day of April, 1865 is a popular day in Lincoln’s presidency because this is the day when, inside the Ford’s theater, Lincoln had gone to watch a play without his bodyguard who apparently had knowledge of the president’s planned assassination. It was while Lincoln watched the funniest part of the play, while seated on the balcony, that he was shot point blank in the head by John Wilkes Booth who had hoped that the noise from the cheers and laughter would swallow up the noise of the gunshot. Booth was captured, however, and the president passed away a few hours later. How to write a five paragraph essay about Abraham Lincoln: In the first paragraph, introduce your thesis. Make sure that you choose a contradictory thesis statement, otherwise, there wont be anything to support with further arguments. Take three major arguments that support your thesis and build three separate paragraphs to describe and support them. Dont forget to add your own opinion, but avoid being too emotional in it. Do you need a top-quality custom essay about Abraham Lincoln? Visit and order a custom written essay now!

The First Jobs of the 2016 Presidential Candidates

The First Jobs of the 2016 Presidential Candidates The 2016 presidential race is underway and things are getting heated. Whether or not your favorite candidate is winning, we thought it would be interesting to explore the humble beginnings of each candidate. Here are the first jobs of each of the 2016 Presidential Candidates held before they got their start in politics.  Source: [payscale.com/]

The influence of e-commerce on the Modern Business Essay

The influence of e-commerce on the Modern Business - Essay Example A survey of academic literature reveals that there are both advantages and disadvantages in resorting to e-commerce. Advantages include lower costs, faster transaction times, and greater convenience in the management of consumer databases. The disadvantages principally concern security measures and the risks of electronic theft and fraud. The report also presents and analyzes the data gathered in a survey conducted among businessmen and customers who use e-commerce, as to the benefits they had experienced as a result of this patronage. The paper concludes with a summary of the report, and insights on the strategic usefulness of this commercial tool in future business transactions. Keywords Electronic commerce, electronic market, modern business, international commerce, EDI, EFT, WWW, information transformation, traditional business, differences. Table of Contents Title Page 1 Abstract 2 Table of Contents 3 Introduction 4 Literature Review 5 E-commerce defined 5 Historical precursors that led to e-commerce 6 E-commerce applications classifications 8 Effects of information technology on electronic commerce 10 Criteria for e-commerce applications 10 Advantages of e-commerce over traditional businesses 15 Future modern business – Issues facing e-commerce in the future 17 Data gathering and analysis 18 Conclusion 25 Bibliography 27 Introduction The topic of this report is about the influences of e-commerce on the modern business. It will include what is e-commerce, give the definitions of e-commerce and explain the different professional nouns, such as B2C, B2B, B2M, B2A/G, C2C and C2A. After that, show the different between e-commerce and the traditional business and how the traditional business has changed today. Furthermore, give the development of e-commerce, show the important impacts of e-commerce, how e-commerce changes since 1970s and what is the main trend of e-commerce in business in different periods. Moreover, it will talk about how e-commerce wil l influence the trend of modern business. In addition, this report wills main focus on the definitions of the e-commerce and the profession nouns and the development of e-commerce. On the other hand, it also will compare the different between e-commerce, tradition business and the international commerce. Aim: This report aims to achieve the following: (1). Looking for different business ways between e-commerce and traditional. (2) Analysis how e-commerce will influence the future society. (3) Demonstrate the vulnerabilities of e-commerce. Objectives The specific objectives of this paper to attain the abovestated aims are the following: (1) Identify ethical, social issues of e-commerce (2) Give the recommendations and improve e-commerce (3) Make a research of how people think of e-commerce Questions: The report shall seek the answers to the following questions: (1) What are differences between e-commerce and traditional business? (2) What are the benefits and the vulnerabilities of e -commerce? (3) Will e-commerce play an important impact in the future? Literature Review E-commerce defined

Global harmonized system Essay Example | Topics and Well Written Essays - 250 words

Global harmonized system - Essay Example Initially, countries venturing into the trade of chemicals used their symbols to represent different classifications. For example, different countries developed their own symbols for acute toxicity in different chemicals. However, this proved to be challenging during trade as the symbol was probably used for a different level of toxicity. As a result, the importing country would not apply the necessary. From the Global Harmonized System classification scheme, acute toxicity is classified under health hazards. Toxicity may be transmitted through oral methods, dermal methods or through inhalation (Kutz. 2009). The standardized symbol for acute toxicity is a skull with cross bones, or an exclamation mark. The exclamation mark applies in chemical hazards that may cause damage to specific body organs. This will allow countries exporting and importing acutely toxic substances to understand the necessary precautions to be applied, in countries that have implemented the Global Harmonized Sys tem.The acute toxicity grid was designed by the United Nation to help in the monitoring of effects of oral or dermal administration of multiple or single dose of a substance within a period of 24 hours. If a chemical substance has an oral LD50 of 295 mg/kg body weight, the GHS category for acute toxicity is category 3(United Nations, 2007). This is because it is close to the maximum range mark of 300 mg/kg body weight. The inhalation LD50 range that will give a category 3 classification for acute toxicity is 50-300 mg/kg body weight.

Processing the Crime Scene and Establishing Identity Essay - 3

Processing the Crime Scene and Establishing Identity - Essay Example However, when using this method the investigator must be careful not to overdevelop the finger prints. 2. There are many types of evidence in crime investigation that should be documented, collected and preserve. The impressions such as finger prints and forensic biology such blood, and body fluid must also be collected. The trace evidences and firearms evidences which include gun powder patterns are needed. Lastly, the question documents must be kept safe. When documenting, collecting and preserving evidence of the crime scene we must make sure that we follow local, state and federal laws for collection and admissibility. The evidences such as drugs, paraphernalia or personal property shall be recorded, collected, and safeguarded in presence of a witness. The investigator shall also participate in the scene debriefing to make sure that responsibilities are well communicated especially those that are post-scene. There should also be markings of the detectives because this will be used in trial and this is the way to prevent any contamination of the evidences and assure that the evidences presented are

Interagency Disater Management of the US Midwest Floods of 1993 and Essay

Interagency Disater Management of the US Midwest Floods of 1993 and how it Might be Managed Different Today - Essay Example When the disaster subsided, meetings and hearings were convened, new policies were drafted, and the administration of Clinton assigned a task force. Key decision makers and legislators required documents, reports, assessments and development programs. A small portion of the population affected by the catastrophic flooding, whether they are on the floodplain or in the Beltway, hope for genuine reform, though, for different rationales: the flood-control strategy as well as the interagency flood management spends too much money, persuades behavior that worsens the predicament, and gives out some luscious boons to a privileged few, which consequently cultivated recurrent environmental crises (Sharp et al., 1997). As soon as the waters ebbed, interests in and attempts for reconstruction have receded as well. The gravely desired reforms in the system will, as the past has showed us, stayed mainly unmade. Afterward, with the following great flood, the same succession of hand-pressing, downpour of sympathy and financial assistance, and the consequent grief about costs, illogicalities, and injustices will be repeated. It is quite terrible. In fact, the solutions are not costly or even technologically complicated. They decided, though, to resolve a number of steamy issues, to deal with the execution rigidly and fairly, and, most importantly, more political moral fiber than is normally observed when flood-management decisions are usually made while the flooding devastates the lives of the people within its reach. In President Clinton’s State of the Union Address in 1994, he referred to the US Midwest Flood of 1993 as a‘500-year flood,’ which consequently led numerous people to think that such a catastrophe, could only occur once every 500 years. However, that is logically invalid. Such a hurricane could possibly happen the following spring. Our watercourses are speckled with â€Å"United States Geological Survey

Theories and Approaches of Policy Evaluation Paper Essay

Theories and Approaches of Policy Evaluation Paper - Essay Example Proper process evaluation helps to ensure that the complete quality of a program is attained by ensuring that it is liable to multiple stakeholders such as the administrators, personnel and community among others. This evaluation helps to identify the process involved in decision making, resourced required in implementation of the technology, the unexpected inconsistencies or prospects while running the program and the legal, social and economic conditions in which the program is run. Process evaluation is a continuous monitoring process that should not interfere with the primary work of an organization. Instead, such information can be used to make the necessary amendments for top performance, especially in the preparation of financial audits (Casey, 2002). Outcome-based evaluation is a vital step when planning a project since it helps in the identification of the possible results of the technology. Outcome-based evaluation is a vital step when developing a new program or analyzing an existing one. This is because the product of the analysis provides good knowledge of the object’s target group and how it will influence the people it serves (Fasten,

Impact of Job Satisfaction on Staff Turnover Literature review

Impact of Job Satisfaction on Staff Turnover - Literature review Example Nature of work is one of the primary factors which help in the development of job satisfaction among the employees. The interest level of the employees in the nature of job which is imposed by the employer guides the job satisfaction. If the employees face person role conflict, then the job satisfaction of the employees will never be high. Person role conflict deals with the fact that employees have to undertake tasks which does not suit them and they are either under qualified or overqualified for the job. The role play of an employee in the job should also provide opportunity for them to utilize their skills which they have learned over the years. The employees should be provided with autonomy in carrying out their jobs. Another important job related factor which helps in the building of the satisfaction is the clarity in the role to be played by the employees. If the employees are made clear regarding the roles which the organization expects from them in carrying out, then a signi ficant amount of satisfaction is generated within them. Proper training regarding the jobs also helps in the development of job satisfaction among the employees as they generate confidence within them through the training process. The employee participation has been one of the crucial aspect in modern times and effective participation of employees in the decision making process of the organization generates a feeling within the employees that they belong to the organization and are an important part of it. This feeling within them in turn imbibes satisfaction regarding their job (Lee, 1991, p.9). The work pressure which an employee has to experience generates the satisfaction level within them. Often employees are dissatisfied with their job owing to the excessive job pressure which they have to face (Spector, 1997, p.24). The above study does not incorporate the factor of place of work and the ambience of the workplace which also often can raise dissatisfaction among the employees in the workplace. Pay package: Pay package is the most important criteria which dominates the level of job satisfaction among the employees. Employees always look for a better pay package and the pay package often helps in balancing the other limitation which an employee may face in an organization. The inclusion of additional facilities in the pay package helps to raise the satisfaction level of the employees and the fulfillment of the demand for increment in the salary structure makes them satisfied in their job. Other than the salary which the employees receive, often employees

Theories and Approaches of Policy Evaluation Paper Essay

Theories and Approaches of Policy Evaluation Paper - Essay Example Proper process evaluation helps to ensure that the complete quality of a program is attained by ensuring that it is liable to multiple stakeholders such as the administrators, personnel and community among others. This evaluation helps to identify the process involved in decision making, resourced required in implementation of the technology, the unexpected inconsistencies or prospects while running the program and the legal, social and economic conditions in which the program is run. Process evaluation is a continuous monitoring process that should not interfere with the primary work of an organization. Instead, such information can be used to make the necessary amendments for top performance, especially in the preparation of financial audits (Casey, 2002). Outcome-based evaluation is a vital step when planning a project since it helps in the identification of the possible results of the technology. Outcome-based evaluation is a vital step when developing a new program or analyzing an existing one. This is because the product of the analysis provides good knowledge of the object’s target group and how it will influence the people it serves (Fasten,

Hinduism, buddhism and sikhism Essay Example | Topics and Well Written Essays - 1000 words

Hinduism, buddhism and sikhism - Essay Example his seven dimensions of religion.These are;practical or ritual,experiential or emotional,narrative or mythical,doctrinal or philosophical, legal or ethical,social or institutional and the material/artistic dimensions. In Hinduism, offerings and petitions are practices which enable them to connect to divine powers so as to solve their problems at the same time fulfilling their desires. Similarly, the Buddhist engage in detailed prayers which are intimate to show dedication to God. The Sikhs engage in a disciplined way of life of Naam Simran which is a way to meditate on God’s name. Hindus of all levels in society perform artistic dance, drama, music, poetry and representational arts and also practice cylindrical festivals which are sacred. Buddhas evoke Sangha to spread Buddha teachings after which the dharma students perform three bows or the three gates (body, tongue and mind). The palms of their hands, knees and forehead should touch the ground to signify earth, water, fire, air and space. The Buddha students bow during prayers with folded hands to signify Buddha of the past present and the future. The Sikhs live a disciplined life and no benefits are gained no matter where one is born since they all have to meditate (by reciting Gurbani and Kurtan which are music hymns) and give selfless service (by doing manual work at the Gurdwara e.g. cleaning dishes and floors) and wear Kesh, Kanga, Kaccha, Kara and Kirpan (Llewellyn 6-18). This refers to feelings and experience of various religions which incorporate stories of how their leaders experienced contact with either divine beings or energies. In Hinduism, Hindus assume to be concerned with spiritual enlightenment or the ultimate act of liberation (moksha). The urban elite and the rural Hindus dedicate their time and energy to obtain prosperity. In Buddhism, the most important emotional experience is meditation that enables emotional awareness and enlightenment. For instance, the Buddha connecting with the

DI-MS Technique for Analyzing Protein and Peptide Sequences

DI-MS Technique for Analyzing Protein and Peptide Sequences Food Industrial Application DI-MS technique has been widely applied in food industry as it is an easy and high-throughput tool for analyzing protein and peptide sequences, studying the components or structure in food, monitoring the contamination in food. FAB-MS In the study by Terzi, Boyot, Dorsselear, Luu and Trifilieff (1990), the amino acid sequence of a new 6.8 kDa proteolipid from beef heart was determined by employed FAB-MS. The study isolated and purified the 6.8 kDa proteolipid from an acidic methanol/chloroform extract of bovine cardiac muscle, and subsequently analyzed it with the application Cs atom beam of FAB-MS in 1-thioglycerol matrix. The result showed a protonated molecular ion [M+H]+ at m/z 6834.1 and indicated that it have about 60 residues. The 60 residues in the polypeptide were cleaved into three peptide fragments CN1, CN2 and CN3. To characterize these cleavage peptides from amino acid composition, the CN1 and CN2 were ionized using the FAB-MS that performed with Xe atom beam and 1-thioglycerol matrix while the CN3 which also dissolved in 1-thioglycerol was collided by Cs atom beam to produce sample ions. Table 1.0: Chemical mass of cleavage peptides Cleavage peptides Measured mass [M+H]+ [M+Na]+ CN1 1539.0 1560.9 CN2 2100.5 2121.8 CN3 3134.6 From the analysis of the cleavage peptides, the amino acid sequence and peptide fragments of the 6.8 kDa proteolipid were reported as: MLQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASS 1 CN1 13 14 CN2 31 32 CN3 AAPAHGHH 60 In addition, the FAB-MS technique was applied to determine the structure of the Lycium chinense Miller fruits (Gou-Qi-Zi) in combination with NMR and IR spectroscopy (Chung, Ali, Praveen, Yu, Kim, Ahmad, 2014). L. chinense fruit is a valuable tonic or food, hence there are many researches have been reported to display the properties the L.chinense fruit. For example, the anticancer, antibacterial and antioxidant properties (Lee et al., 2005; Wang, Chang, Inbaraj. Chen, 2010; Zhang et al., 2011) and the antihepatotoxic activity and chemical constituents (Chin et al., 2003; Kim et al., 1997). In the research, the four new compounds (i, ii, iii and iv) that isolated from L. chinense fruits were characterized using the FAB-MS (JMS-700) spectrometer. The antioxidant activity of the four compounds was further studied and it demonstrated that the activity of the compounds followed the order 1423. Table 2.0: Characterization of compound (i) to (iv) Mass Species m/z Detected species Suggestion Compound (i) [M+H]+ 817 C40H65O17 -aromatic acid glycosidic ester 283 [CH3(CH2)16COO]+ -steric acid was esterified with one phenolic group 267 [CH3(CH2)16CO]+ 414 [C15H26O13]+ -three arabinose units bind to one phenolic group 265 [C10H17O8]+ 133 [C5H9O4]+ Compound (ii) [M+H]+ 1165 C50H85O30 -susquiterpene glycoside ester 265 [C10H17O8]+ -few arabinose units bind to the sesquiterpene moiety 223 [C14H27CO]+ 133 [C5H8O5]+ Compound (iii) [M]+ 1309 C58H100O32 -hexaglycoside 341 [C12H21O11]+ -six hexose sugar units bind to each other -unsaturated fatty acid located at terminal position 335 [C21H39COO]+ 325 [C12H21O10]+ 319 [C12H39CO]+ 179 [C6H11O6]+ 163 [C6H11O5]+ Compound (iv) [M+H]+ 841 C31H52O26 -five arabinose units and one glucose unit 661 [C25H41O20]+ -five pentose sugar units bind to a hexose sugar 529 [C25H41O20-C5H8O4]+ 281 [C10H17O9]+ TOF-SIMS TOF-SIMS which widely applied in surface analysis is an important technique for monitoring the contamination in food as the usage of pesticides and fungicide in the agriculture practice will alter and compromise the food quality. The study used TOF-SIMS technique to characterize and compare three different groups of Seggianese olives which classified as untreated (UT), treated with insecticide (dimethoate) and fungicide (copper oxychloride) without washing (TU) and treated with insecticide and fungicide with washing with cold water (TW) (Focardi, et al., 2006). Before measuring the molecular masses of three different groups of olives, the mass calibration was done by using CH3+, C2H3+ and C3H5+ peaks as calibration compounds for positive ions C, CH and C2H peaks as calibration compounds for negative ions. The SIMS data proved the chemical treatments modify the surface composition of olive, resulting in higher intensity signals in TU compared with TW or UT olive spectra. Besides, the intensity of UT and TW olives showed a small variance between each other, demonstrating the washing process was no effective in removing of insecticides and fungicides that will stimulate the composition alterations of olives. Table 3.0: Intensity of few relevant peaks from three different olive samples Peaks Mass peak m/z Attribution Intensity TU olive TW olive UT olive Positive 31.018 CH3O+ 4.23 10-4 6.93 10-5 1.12 10-4 57.074 C4H9+ 1.18 10-2 5.92 10-3 5.08 10-3 73.051 C4H9O+ 7.83 10-4 3.34 10-4 3.08 10-4 147.082 C6H14NOP+ / C6H13NOS+ 2.42 10-4 7.37 10-5 2.93 10-5 Negative 15.994 O 1.13 10-4 2.30 10-3 7.20 10-3 17.002 OH 1.19 10-4 4.42 10-3 5.44 10-3 31.972 S 5.24 10-4 1.99 10-5 1.47 10-5 MALDI-TOF/TOF MS MALDI-MS is a widespread analytical tool for proteins, peptides and oligonucleotides as it offers high ion yields of the intact analyte samples, high sensitivity and accuracy (Lewis, Wei, Siuzdak, 2000). In year 2012, a research about the peptide of peanut hydrolysate has the properties of umami taste had reported by Su, Cui, Zheng, Yang, Ren Zhao. Umami taste is known as the fifth basic taste and it usually described as savory or MSG-like taste. In the study, two novel umami and umami-enhancing peptides were isolated from peanut hydrolysate, purified using chromatography and identified by MALDI-TOF/TOF MS. The analysis of peptides was performed by MALDI-MS equipped with 337nm of UV nitrogen laser and matrix solution as sinapic acid saturated in 0.1% trifluoroacetic acid and acetonitrile. The MALDI-TOF/TOF MS was used to sequence the two novel peptides that termed as P3 and P4 as they produce umami taste. It found that the molecular mass of P3 and P4 was 1091.419 Da and 965.595 Da respectively and the amino sequence of P3 is EGSEAPDGSSR while P4 is SSRDEQSR. Bibliography Chung, I. M., Ali, M., Praveen, N., Yu, B. R., Kim, S. H., Ahmad, A. (2014). New polyglucopyranosyl and polyarabinopyranosyl of fatty acid derivatives from the fruits of Lycium chinense and its antioxidant activity. Food Chemistry, 435-443. Focardi, S., Ristori, S., Mazzuoli, S., Tognazzi, A., Leach-Scampavia, D., Castner, D. G., et al. (2006). ToF-SIMS and PCA studies of Seggianese olives and olive oil. Colloids and Surfaces, 225-232. Lewis, J. K., Wei, J., Siuzdak, G. (2000). Matrix-assited laser desorption/iomization mass spectrometry in peptide and protein analysis. Chichester: John Wiley Sons Ltd. Su, G., Cui, C., Zheng, L., Yang, B., Ren, J., Zhao, M. (2012). Isolation and identification of two novel umami and umami-enhancing peptides from peanut hydrolysate by consecutive chromatography and MALDI-TOF/TOF MS. Food Chemistry, 479-485. Terzi, E., Boyot, P., Dorsselear, A. V., Luu, B., Trifilieff, E. (1990). Isolation and amino acid sequence of a novel 6.8-kDa mitochondrial proteolipid from beef heart. FABS Letters, 122-126. Conclusion In food industry, the analysis of protein and peptide can be performed well by using MALDI-MS and FAB-MS while the application of SIMS is mostly used for detecting the surface of contaminated food. Besides, the structure of the components in foods can also be identified by using the FAB-MS combined with NMR and IR spectroscopies.

Silence in a Classroom :: Learning Teach Teachers Papers

Silence in a Classroom How can silence be put to use in a feminist classroom? What are the positive ways to cultivate silence, ways which empower, rather than shut down? Audre Lorde has been widely quoted on the negative impacts of silence on women. She uses the term "silence" as an active verb; those with power have historically silenced others.But I am interested in the other implications for silence, namely, using silence as a tool:for discovery, creation, and real critical thinking.Our culture is afraid of silence.We bombard ourselves with cell phones, television and radio. Often the assumption is that if someone is not talking, it must be a "bad" thing.As teachers, we replicate this model in our classrooms.We feel that students must really be getting something out of our classes when they talk about what they are learning.But does talking always insure that a student has really processed the material and made it her own? Or is talking in class often another form of performing for the teacher? Particularly in a writing class, where students are practicing putting words down on the page, cultivating a silent space seems imperative.My belief is that the more students are encouraged to write rather than talk in the composition classroom, the more they will trust their stance as authors of their own pieces.Silence can be an opening into the untapped places where deep, explorative writing is created.Peter Elbow writes about "felt sense," the way we can feel whether or not our intentions are being expressed in our writing by "listening" to our bodies: The foundation of verbal meaning often lies in the silence of what is felt nonverbally and bodily.When writing goes well, it is often because we periodically pause and say, 'Is this what I mean to be saying?'It's amazing that we can answer that question:that we can tell whether a given set of words corresponds to an intention.The source of the answer is the feelings and the body-consulted in silence.When writing goes badly, it is often because we don't make these pauses for quiet consultations with felt sense. (Everyone Can Write 176) Many of our students are just learning to "trust" themselves as writers.Most haven't had the opportunity in high school to explore what writing can do for their thinking; they have been taught that "writing" is a product produced for a teacher.Student-centered pedagogy seeks to de-center teacher authority, and has moved away from traditional methods such as the lecture format to more group discussion.

Max Weber on Society Essay -- Max Weber sociology sociological Essays

Max Weber on Society Max Weber was one of the world's greatest sociologists and wrote a lot about the capitalist world he lived in. He had a different conception of capitalist society than most of his contemporaries. He looked at capitalism from all the different aspects that the philosophy was made of. Some of these aspects are state power, authority, class inequality, imperialism, and bureaucracy. To understand how Weber thought one must look at each area separately then put them all together in a global package. Weber describes history in terms of the constant struggle for power. He bases all significant historical changes on the power struggle that caused them. Weber describes power as a zero sum game. That means for one person to gain power, someone else has to loose the same amount of power. A fundamental aspect of the power struggle is the state, and its power. Weber states that the state is the monopoly of legitimate force. The state is a compulsory of power, and the laws within it are its powers to enforce its power. The main struggle for power is that of force verses authority. Force is power that can be used to get one's way, and authority is the legitimate use of power to rule. Within the struggle for power, Weber defines three forms of authority: rational-legal authority, traditional authority, and charismatic authority. Rational-legal authority is anchored in impersonal rules that have been legally established. This type of has come to characterize...

Policing Reforms Essay

When reading the case study from Chapter eight in â€Å"Criminal Justice Organization† that dealt with policing reforms and how to implement those several questions were raised at the end of the chapter that I would like to address.   The first was the obstacles to those putting these reforms into place.   What were the issues and concerns of the officers when putting these new reforms into place?   Would these new supervisory reforms be accepted well with the officers and the department?   Would the fears of the community and officers be calmed by supervisors and how would the supervisors do this?   These questions I hope to answer in this essay and allow the reader to see just how effective these reforms are for a healthy society, community and police force. Policing reform includes communities as well as police departments.   Policing and community involvement, to me is more of a democratic policing for society.   Many departments have had issue with their officers and this reform.   But with contemporary styles being introduced the picture is changing.   In the article the officers at fires thought that, â€Å"More contemporary approaches to policing such as community policing ideals and practices, were â€Å"Bullshit† and coddling criminals, as far as he was concerned† (p.207). A new supervisor with the new reforms in mind came into his position with real motivation to change the face of the police department.   â€Å"Bratton had adopted an idea postulated by some Ivy League types that the erosion of quality of life in a community led towards urban decay and ultimately unchecked crime† (207).   The new supervisor had discussed with police and politicians how working with the community and their concerns actually showed a decrease in crime.   He also went on the say that this involvement with the community can be as simple as social programs that would meet individual’s basic needs to the cleaning of neighborhoods and cracking down on crime.   Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚   Shifts in the structure of policing would need to happen.   These changes would include more concentration on â€Å"community policing principals† (207).   Other things would be creating substations or mini-stations around the community to keep officers close to their respective communities.   The ideal being the better you know you community the more effective and efficient the officers would be.  Ã‚   Creating watch groups and have weekly meeting with members of the community to pinpoint problems. What better policing than community policing.   Also, also talking with landlords and business owners on effective efforts and ways they can help to prevent drugs and drug houses moving into the community.   Enhancing direct services such as issues with community health in the article the new supervisor had even tried to implement a plan that would involve officers giving aid in transportation to health clinics and departments but liability issues prevented this from happening.   I think this will be something that we could see happening in the policing functions in the near future.   Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚   The officers in the story felt that these efforts and concepts of policing reforms were just â€Å"a waste of time† (208).   They had issues with how their performance had been evaluated in the past verses how they would be evaluated after the reforms were in place.   The new policies required more involvement with the communities and getting a sense of unity with the community. â€Å"The purpose of these efforts was to get a feel for the pulse of the community and its problems† (209).   The officers had a problem with evaluations being group instead of being based on individual merit.   But in my opinion this would strengthen the department on a whole.   Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚   Police supervisors according to the article are to interact more with the officers.   Don’t use status to separate them from their subordinates getting them involved to identify problems and crime in the community making the officers the experts of their own community.   Supervisors would be seen as support and an in-between for the officers and the upper level management in the department along with being a catalyst between police and the community.   The officer in the story opposed to these changes brought in the union citing that he felt this unfair and a violation of his labor agreement, but the reforms were not seen as being unfair or a violation.   Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚   I don’t believe him to be idealistic rather unmotivated to change, because once the officers saw that results for the good of the community their minds were changed very quickly.   If something works and is good for the group as a whole then ethically you would have to change your attitude. There was also improvement in officer’s jobs that could be seen, such as more say in how they thought they should do their jobs.   Since they are the ones actually on the beat forty hours or more a week, somehow being your own critic makes you the best critic for the job.   Supervisors are fundamental in addressing the fears of officers as well as communities.   A supervisor that has strong managerial skills and an ability to show strong leadership and direction would benefit any police department and help in implementing policing reform in any police department. Reference: Stojkovic, S., Kalinich, D., & Klofas, J. (2003).   Personnel, supervision, and evaluation.   Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚  Ã‚   Ch. 8.   Criminal Justice Organization.   New York: Wadsworth/Thompson

Assessment in Special Education Essay

Abstract Sometimes the general education program alone is not able to meet the needs of a child with disabilities, and he/she may be able to receive special education services. The evaluation process can be a very difficult task when trying to identify if the child qualifies for special education, schools often have a pre-referral intervention process. The most prominent approached used today is the â€Å"response-to-Intervention† or RTI. Special Education teachers face many challenges when trying to meet the needs of special needs students in their classrooms. Methods of evaluation are a big concern and challenge for educators of special needs students today. In addition, meeting everyone’s needs is a difficult task to accomplish because of students’ diverse abilities in the classroom. This research paper will explore the different methods of assessment in special education programs and the best practices to help this children achieve their potential in an appropriate setting. Testing and assessment is an ongoing process with children in special education programs. Some of these assessments include, developmental assessments, screening tests, individual intelligence tests, individual academic achievement tests, adaptive behavior scales, behavior rating scales, curriculum-based assessments, end-of-grade, end-of-course, and alternate assessments. Comprehensive assessment of individual students requires the use of multiple data sources. These sources may also include standardized tests, informal measures, observations, student self-reports, parent reports, and progress monitoring data from response-to-intervention (RTI) approaches (NJCLD, 2005). The main purpose of a comprehensive assessment in the special education field is to accurately identify the strengths and needs of the students to help them be successful during their school years and there after. Legislation has played a big role in the shift towards functional assessment. The Individuals with Disabilities Education Act is also known as the Education for All Handicapped Children Act has played a big role in this matter. The IDEA legislation â€Å"needed to assure that students with disabilities receive free appropriate public education (FAPE) and the related services and support the need to achieve† (Jeffords 1). IDEA was created to make sure that disabled children are receiving fair and equal education and support. This act has several parts to it which include providing grants, funds early intervention services, and supports research and professional development programs. The No Child Left Behind Act: Impact on the Assessment of Special Education Student. After the No Child Left Behind Act (NCLB) moved into our schools there is a great deal of controversy that questions whether the act implemented by President George W. Bush is helping or hurting an already suffering school system. There are many dimensions of the NCLB act that have been questioned over the past decade; the fair assessment of students with disabilities is one of them. As the National Center for Fair & Open Testing (NCFOT) reported, the public relations aspect of this act is strong. Prior to the Individuals with Disability Education Act of 1997 (IDEA) students in special education were exempt from participating in the statewide testing. However, the IDEA advocated that all students including those with special learning difficulties should be able to participate in testing. (Cahalan, 2003). Legislative Overview of Laws Protecting Special Education Students On January 8, 2002, President George W. Bush signed the NCLB act. In this act the federal government was for the first time in the history of the Department of Education putting an act into effect that would penalize schools that failed to meet adequate yearly progress (AYP). The AYP is a measuring system in which the federal government will look at the progress of the local government and school systems to decide whether or not that school, along with its teachers and students, has progressed and provided a high-quality education (Goldhaber, 2002). Through the NCLB act schools are held accountable for failing test scores and failure to improve their class average from one year to the next. The longer the school fails to meet required scores, the more the school will be held accountable, and the greater the consequence. For instance, a school that is unable to make their desired AYP and has not improved a significant amount within five years will then be subject to reconstruction. This reconstruction could include the government completely taking over the school and hiring new teachers and  teacher staff, leaving many teachers and staff unemployed (Goldhaber, 2002). Teachers and students in the special education department do have some laws however that helps them make testing less stressful. The Rehabilitation Act of 1973 required that accommodations must be made for students with learning disabilities in order to be able to participate in the assessment (Cahalan, 2003). However, this leaves the question of what can be used as accommodations. Accommodations could include things such as test schedules and setting of the test, along with the format of the presentation. Also used to help the special education students and teachers is the individualized education plan (IEP). The Individuals with Disabilities Educational Act (IDEA) of 1991 would set into effect the idea of an IEP. An IEP is a plan that is set by a group of individuals that work closely with the student to design the educational format that is most appropriate for him/her (Cahalan, 2003). This does not take into account the type of disorder the student has but simply the student themselves. The individualized attention that is given with this plan provides the student with the correct instruction needed to be successful in education. These groups of individuals include the teacher, parent, school psychologist and anyone else that is closely related to the education of this student. The IEP members are, in most states, responsible in deciding which accommodations are important for each individual student (Cahalan, 2003). They, however, are not a part of deciding what accommodations will be provided for each student during the NCLB assessment. The laws described here were all implemented with the same goal in mind; to protect special education students and be sure their quality of education is the same as all other students. However some of these laws, including the NCLB, must be altered in order to truly give special needs students the education and assessment they deserve. Best Practices in Assessment of Special Education Students Students in special education programs should be included in the statewide assessments, as the IDEA of 1997 states. The IDEA also states that accommodations should be made to be sure that the student is able to fully understand the materials they are asked (Cahalan, 2003). There are four categories of test accommodations, presentation, response, timing, and  setting (Cahalan, 2003). Presentation is simply visual aids that help the student fully understand the context. These do not alter the questions of the test; they simply make it accessible for the students. Presentation accommodations include Braille, large-print, sign language interpreter, or reducing the number of questions per page (Cahalan, 2003). These simple accommodations make test taking less stressful, and therefore the material is better understandable by the student. However, no state has reported using them in their statewide assessments since the inception of the NCLB. In a study of over one thousand students it was found that using a video presentation to help understand the test showed a significant increase in their achievement (Cahalan, 2003). So why is the educational department not using these modifications that help so much? Another form of accommodation used in special education testing is response. It may be as simple as giving an oral response instead of a written one or it may mean that the test is dictated to the student by a recorder. These accommodations in no way alters the response that is given or received, it is still the same question being asked. Results have shown that by providing a reader special education students showed a significant improvement in their test score (Cahalan, 2003). The last two accommodations are setting and timing. The timing could include any extra time needed, breaks during the exam, or spreading the testing out through a few days instead of taking it all in one day. And the final accommodation is setting, which could include special furniture, lighting, or an individualized testing area (Cahalan, 2003). Even though there was no evidence to prove that setting and timing are important accommodations, it is well known that many special education students are tested in private rooms with more time. These accommodations should be accessible for special education students that need them to better their test taking skills. However, many states do not allow such accommodations to be made due to the misconceived conception that they change the contents of the test when in actuality they do not in any way alter the questions asked. BEST PRACTICES IN ASSESSMENT HANDOUT †¢Create a shared mission and goals statement that reflects an emphasis on student learning. †¢Focus on collaboration and teamwork. Faculty members must agree on assessment goals for planning to be meaningful. They may have to rise to a higher level of collaboration than may have been traditionally practiced in most departments. Collaboration within the department, across departments, and with higher administration will facilitate the best outcomes from assessment planning. All constituents must recognize that assessment skills must be developed and that colleagues can assist each other by sharing practices and strategies. †¢Clarify the purpose of assessment. Assessment can serve dual purposes: Assessment can promote student learning or provide evidence for accountability requirements through an evaluation of strengths and weaknesses. Wherever possible, students should experience a direct, positive benefit from their participation in assessment activities. †¢Identify clear, measurable, and developmental student learning †¢OUTCOMES. Explicit identification of learning expectations facilitates the department’s coherence about their GOALS. Sharing those expectations explicitly with students can provide an effective learning scaffold on which students can build their experiences and render effective performance. †¢Use multiple MEASURES and sources consistent with resources. Effective assessment planning can only occur when properly supported with appropriate time, money, and recognition for good work. The expansiveness of the assessment plan will depend on those resources. As resources permit, additional MEASURES can be added to planning. These MEASURES address variations in learning style, differences in types of learning, and interests from varied stakeholders. †¢Implement continuous assessment with clear, manageable timelines. Better assessment practice involves spreading out assessment activity throughout the year and across years rather than conducting a marathon short-term assessment effort in a single year. Projecting a schedule of regular formal reviews can facilitate appropriate interim activity. †¢Help students succeed on assessment tasks. Students will fare best in assessment activities when faculty make expectations explicit, provide detailed instructions, and offer samples or models of successful performance. They will benefit most with opportunities to practice prior to assessment and when given detailed feedback about the quality of their performance. †¢Interpret and use assessment results appropriately. Assessment should be a stimulus for growth, renewal, and improvement, not an action that generates data to ensure positive outcomes. Linking funding to assessment outcomes may encourage artificial results. Assessment data should not be used for personnel decisions. If cross-institution comparisons are inevitable, care should be taken to ensure comparisons across comparable institutions (benchmarking). †¢Evaluate your assessment practices. Results from assessment activity should be evaluated to address their reliability, validity, and utility. Poor student performance can reflect limited learning or an ill-designed assessment process. Examining how effectively the assessment strategy meets departmental needs is a critical step in the evolution of the department plan. (Retrieved from www. caspercollege. edu/assessment/downloads/best_practices. pdf) The Effect of NCLB Assessments on Special Education Programs When the Department of Education was asked how they intend to insure that special education students will not be forced to take tests that are above their intelligence level under the NCLB act, they could not give a real solution. They simply said that there are accommodations available, and if the student’s disability is severe to the point that the accommodations will not help, there are alternate tests they can take (Education Week, 2003). However, the problem with this is that there is no clear definition as to who is able to receive these accommodations and who is able to receive the alternate assessment. Who decides this? And how handicapped must a student be in order to receive an alternate assessment? Even though special education students are not at the same intelligence level as their peers they are still placed in the same test group as them. The NCLB act does not include in its AYP percentage the failing percentage rate of special education students in each given population. Therefore, teachers and school administration are trying to make up for the percentage loss in special education departments. Some teachers are now, for the first time, being held accountable for failing test scores. This, in effect, causes teachers to alter their curriculum and teach to the test? (Goldhaber, 2002). By teaching to the test students are missing out on important curriculum information that may be overlooked completely or presented in short educational lecture in the middle of teaching test taking skills and other information that may be found on the assessments. Possible Improvement to the Assessment and Accountability. To improve the NCLB act we must first know what is wrong with the act. While the idea of leaving no child behind in education is a good plan, there are still a few loop holes that the president’s act needs to clear up. The students that are placed in the special education setting are usually there because they have a disability or are below average in their cognitive abilities. In order to be fair to these students the government must be sure that they have the same quality education as all other students, but the government must also realize that the curriculum of the material they are learning may in some cases be drastically different. With this knowledge, it must then be known that to accurately and fairly assess special education students the assessments must be built with the correct accommodations. In order for this to happen, those who design the tests must develop an exam that meets the needs of the student, and not the needs of the disorder. In other words, do not test a student as an autistic child but first look at their individual advantages and disadvantages according to each test taking skill. Some students may simply need more time, while others will need more time along with a person to read to them and interpret some larger word usage. It is all based on the student’s individual needs (Cahalan, 2003). In other words the decisions of the accommodations should be made by people that know the student on a personal level, and know what accommodations are present in their current education setting. As stated before, with some assessments the IEP will meet to determine what accommodations will be made for the students in that assessment, However, this is not the case in the NCLB assessments; but it should be. Those who are teaching and raising the child should be a part of the process of determining how the child is assessed and what accommodations are necessary (Washington, 2003). It is important for the education of future special education students that the Department of Education take into consideration the possible reforms that were suggested by many local government and teachers surrounding them. Improvements can be made to the assessment of special education, and should be made to be sure that all students are receiving a fair and adequate education. Disproportionate identification of minorities in some special education categories: When speaking of the learning disabled, minorities, one must consider some dimensions to the issue of assessment within a particularly specialized light. This special population reflects both the learning disabled (LD) and the minority that they belong to. This is largely the case within a practical context, although as the literature points out, pre-considerations must be afforded for minority students. To begin with, it is important to look at the many variables that exist within the aforementioned components. These components include English as a Second Language (ESL), socioeconomic level and finally the impact this has on teaching the learning disabled in a classroom setting and more specifically when employing the assistance of a translator. Curriculum-based assessment is hampered with some biases that can affect these students (Dolson, 1984). A child’s race and ethnicity significantly influence the child’s probability of being misidentified, misclassified, and inappropriately placed in special education programs. Research shows the relationship between race and ethnicity and other variables for students’ placement in special education classes. Variables such as language, poverty, assessment practices, systemic issues, and professional development opportunities for teachers have been cited as factors that play a role in disproportionate representation (emstac. org). Children from culturally and linguistically diverse backgrounds should be able to receive an excellent and appropriate education. Some students are not included in special education programs, even though they have a disability that is affecting their ability to learn and they need special education help. Some CLD populations are also significantly under-represented in programs for the gifted and/or talented. In these instances, CLD groups are considered under-represented because the proportion of students from certain ethnic or racial groups who receive special services are significantly less than the number of these same students in the overall school population (U. S. Department of Education, 2004). Facts: †¢ Hispanics are under-identified within certain disability categories compared to their White peers (U. S. Department of Education, 2006). †¢ Asian/Pacific Islander students are actually less likely to be identified for special education services than other CLD populations (NABE, 2002). There are a number of possible action steps school personnel can take to ensure that individual assessments are conducted in a culturally responsive and nondiscriminatory manner (Klotz & Canter 2006). Recommendations include: †¢Allowing more time. Assessments of students from diverse backgrounds require more time to gather important background information and allow for alternative and flexible procedures. †¢Gathering extensive background information. To provide a context for the evaluation, conduct a review of all available background information including: school attendance, family structure, household changes and moves, and medical, developmental, and educational histories. †¢Utilizing student progress monitoring data from Response-to-Intervention (RtI) or problem-solving processes. Data generated from a process that determines if the child responds to scientific evidence-based interventions should be included in a comprehensive evaluation. The National Research Council on Minority Representation in Special Education recommended the use of data from a systematic problem-solving process measuring the student’s response to high quality interventions (National Research Council, 2002, pp. 7-8). †¢Addressing the role of language. Determining the need for and conducting dual language assessments are essential steps in an evaluation process. This includes determining the student’s language history (i. e. , ages that the student spoke and heard various languages), dominance (i. e. , greatest language proficiency), and preference (i. e. , the language the student prefers to speak). †¢ Using nonverbal and alternative assessment strategies. When assessing students from CLD backgrounds, use standardized nonverbal cognitive and translated tests (when available in the target language). Additional assessment techniques, including curriculum-based assessments, test-teach-test strategies and in-direct sources of data, such as teacher and parent reports, portfolios, work samples, teacher/student checklists, informal interviews and observations, and classroom test scores are also helpful in completing an accurate, comprehensive evaluation (NEA, 2007). Bibliography Bush, President George W. (December 3, 2004). Bipartisan Special Education Reform Bill. Retrieved from http://www. ed. gov/news/newsletters/extracredit/ 2004/12/1203. html Cahalan, C. & Morgan, D. L. (2003). Review of state policy for high stakes testing of students with disabilities on high school exit exams. Educational Testing Service. Department of Education. (2003). Title I ? Improving the Academic Achievement of the Disadvantaged; Proposed Rule. (34 CFR Part 200). Washington, DC: U. S. Government Printing Office. Dolson, David P. (1985). â€Å"The Effect of Spanish Home Language Use on the Scholastic Performance of Hispanic Pupils. † Journal of Multilingual and Multicultural Development, V. 6, No. 2,50. Fair Test. (2005). The National Center for Fair & Open Testing. Retrieved from http://www. fairtest. org on October 12, 2011 Goldhaber, D. (2002). What might go wrong with the accountability measures of the? No Child Left Behind Act? The Urban Institute. IDEA Partnership. http://www. ideapartnership. org Klot z, M. B. & Canter, A. (2006). Culturally Competent Assessment and Consultation. Retrieved October 2011 from: http://www.naspcenter. org/principals/Culturally%20Competent%20Assessment%20and%20Consultation%20NASSP. pdf. Improving accountability for limited English proficient and special education students under the No Child Left Behind Act. (2003). Washington Area School Study Council. National Association of School Psychology. (2007). The Truth in Labeling: Disproportionality Special Education. Retrieved from www. nea. org/books on October 15, 2011. National Joint Committee on Learning Disabilities. (2001a). Issues in learning disabilities: Assessment and diagnosis. In Collective perspectives on issues affecting learning disabilities (2nd ed. , pp. 55–61). Austin, TX: Pro-Ed. (Original work published 1987) National Joint Committee on Learning Disabilities. (2005). Responsiveness to intervention and learning disabilities. Available from www. ldonline. org/njcld. National Joint Committee on Learning Disabilities. (2007). The documentation disconnect for students with learning disabilities: Improving access to postsecondary disability services. Available from www. ldonline. org/njcld National Center for Culturally Responsive Educational Systems. (Fall 2005). Cultural considerations and challenges in response-to-intervention models. An NCCRESt position statement. Retrieved October 2011 From http://www. nccrest. org/PDFs/rti. pdf? v_document_name=Culturally%20Responsive%20RTI. No educator left behind: Testing special education students. (2003). Retrieved October 15, 2011, from http://www. education-world. com/a_issues/NELB/NELB025. shtml Olson, L. (2004). Data show schools making progress on federal goals. Education Week, 24, 24-28. Retrieved from http://www. edweek. org Tomes, H. Ph. D. (2004). In public interest: Are we really leaving no child behind? American Psychologist, 35, 31-35. Retrieved from www. apa. org on October 15, 2011 U. S. Department of Education. (2004). Twenty-fourth annual report to Congress on the implementation of the Individuals with Disabilities Education Act. Washington, DC: Author.

Booker T vs Washington

Booker T Washington and W. E. B Du Bois offered different strategies for dealing with the problems of poverty and discrimination faced by black Americans at the end of the 19th and beginning of the 20th centuries. By using my knowledge of the documents and my knowledge of the period 1877-1915, I was able to asses the appropriateness of each of the strategies in the historical context in which it was developed. I came to the conclusion that Booker T Washington’s strategy was more appropriate for the time period 1877-1915 then was W. E. B Du Bois’ strategy. A summarization of Booker T Washington’s strategy presented in The Atlanta Compromise Address or â€Å"Document D† would be to say that he wanted all black Americans to learn trades. He wanted them to pass on those skills, and use those skills so their families could have a better life. â€Å"Cast down your bucket where you are†¦while doing this you can be sure in the future, as in the past, that you and your families will be surrounded by the most patient, faithful, law-abiding, and un resentful people that the world has seen. †-Document D. This excerpt from the document basically says that when we are taught a specific trade and teach it to our families, they can in turn be successful and live good lives in the future. Because of you learning this skill and in turn teaching it to your family, they will be better off. A summarization of W. E. B Du Bois strategy can be described as ceaseless agitation stated in â€Å"The Niagara Movement†- â€Å"The Niagara Movement proposes to gain these ends†¦. If we expect to gain our rights by nerveless acquiescence in wrong, then we expect to do what no other nation ever did. What must we do then? We must complain. Yes, plain, blunt complain, ceaseless agitation, unfailing exposure of dishonesty and wrong- this is the ancient, unerring way to liberty, and we must follow it. †-Document F I disagree with his strategy for the period 1877-1915 for he only thought about a small number of the black race, the top ten percent. He was going to send them to Harvard and some how they were going to become the intelligence for the black race as a whole. This also appoints only specific figures as a mini government of the black race. Mainly in Booker T Washington’s proposal, it just seems as if he included the whole race as opposed to W. E. B’s proposal pertaining to only a small select few. By looking at the â€Å"School Enrollment Graph† in Document A, it seems as if the W. E. B strategy would have a better chance of working in a later time period. In the time period of 1877-1915, there really were not a lot of black Americans enrolled in school. The rate does rise; showing that after 1915 there would be a much better chance of any percent of Black Americans getting into college. I can also be seen in Document B-â€Å"Illiteracy by Race†, that Black people were becoming more and more literate, allowing them to thus go to college. It appears that in the ladder of the time period we are discussing, that there is a much larger opportunity for black Americans to go to college and progress while there, than there is a chance for them to go to go to college in the beginning of the time period being discussed. Another reason it seems the Booker T Washington’s way is more appropriate is because it worked. By looking at Document C- â€Å"Lynchings by Race†, the amounts of black lynchings were becoming more and scarcer. This is perceived by me in a number of ways. First off, black Americans were learning skills now by the way of Booker T, and were not only becoming smarter, but they were becoming more important to other persons. Their skills were needed by others which not only gave people a reason not to lynch them, but it also introduced many people to more black Americans, thus putting a personal perspective of actually knowing someone. A person would much rather lynch someone that they did not know personally, than someone that they get potatoes from. In Document G, Booker T is praised by T. Thomas Fortune, a black activist and newspaper editor who writes about BTW in the nationally circulated black periodical, â€Å"Christian Recorder. He is spoken of as a man whose value is impossible to estimate. His work involving Tuskegee College is hailed for having 400 students, great teachers, splendid farm equipments, stock-raising, fruit culture, laundry work, practical housekeeping, blacksmithing, wheelwrighting, carpentering, and more, all this while a normal school system is maintained. â€Å"No time is wasted on dead languages or superfluous studies of any kind. What is practical, what will best fit these young people for the work of life, and that is taught, and is aimed at. This shows that his approach was actually working and this is evidence enough for me to say that I believe by using my knowledge of the documents and my knowledge of the period 1877-1915, I was able to asses the appropriateness of each of the strategies in the historical context in which it was developed. W. E. B just might have been a little before his time with his views. Maybe later when the literacy rate would be higher and more black Americans were being accepted to college, his idea could have worked, but there would be many smart and skilled black Americans all from the concept given by Booker T Washington.

The New Jim Crow Essay Example | Topics and Well Written Essays - 250 words

The New Jim Crow - Essay Example have been facing a number of consequences barring them from gaining equal representation in the country which has been posing as a problem especially to those that have been boxed as prisoners. The author writes, â€Å"The clock has been turned back on racial progress in America, though scarcely anyone seems to notice. All eyes are fixed on people like Barack Obama and Oprah Winfrey who have defied the odds and achieved great power, wealth and fame.† An insight has been provided into the Jim Crow laws which in the past had replaced slavery and thus an explanation of how the same is required in order to deal with minority groups of people belonging to different castes so as to not relegate them to a racial status. The main aim of this piece of writing is to renovate the idea of human rights and equality in the minds of people in order to provide justice to criminals as well as make transparent data and information before wrongfully incarcerating

Strategic Plan,Conceptualizing a Business Essay Example | Topics and Well Written Essays - 750 words

Strategic Plan,Conceptualizing a Business - Essay Example It has the ability for catering of services for both females and males in the area. To ensure that clients get quality services and products; to enhance their mental relaxation and improve on their physical appearance. Being a reputable salon; that offers quality products and services at fair prices (Hormozi et al., 2002). Disney has been a leading hair stylist in the city has worked with major beauty â€Å"spas† that deals with top models and wealthy clienteles. Through the three years of experience in upscale salons Disney has been able to create a reputable name in the beauty stylish industry with a strong base of clienteles. Working with her fellow beauticians; Disney is most destined to build this business enterprise a successful undertaking. Forming from this reputation already earned this company tends to attract more clients and continue the growth of the company. Our business company is located in one of Greensted busy streets which is easily accessible to any person, thus our clienteles won’t find difficulty locating us. The environment is conducive with enough space that ensures the clients receive professional services and recreation. Our business provides quite a variety of products and services all under one roof, and we are flexible in the working hours to suit our customers’ needs. The high reputation of our staff and the owner of being able to offer quality services to suit each customer needs will earn us more new clients and strengthen the relationship with our current clients (Karlsson & Honig, 2009). The company will provide services that cater needs of the whole family setting; that are convenient to children, women and men. These diverse services are: 1) Hair services: shampoo, weaving and waving, colors, haircuts, conditioners, relaxers, curling, perms and reconstructing; 2) Skin care services: facials, massage, and body waxing. 3) Nails Services: polish, manicures,

Training Module Essay Example | Topics and Well Written Essays - 500 words

Training Module - Essay Example It will be part of their work duties. The training will teach the workers how to maintain a healthy lifestyle outside of the workplace to foster a better performance inside the workplace. The purpose of conducting this training is partially to reduce drama in the workplace. Many people come into the workplace with lots of drama issues surrounding their personal lives, which is not acceptable in the workplace. Relationships are important, but details about private relationships should be kept just that—private. People who are working with other workers do not want to hear their co-workers talk about how much someone had to drink the night before, their problems with their significant other or others, and who is sleeping with whom. It’s quite unprofessional and does not reflect the kind of worker that the company wishes to employ. Workers who do not abide by the work/life balance training will be considered for termination or face some kind of penalties. This work/life balance training module has several objectives. One of the objectives is getting employees to â€Å"prioritize† tasks in their lives so that their lives will be more efficient, and thus make them better workers.1 People who prioritize their tasks appropriately are more able to complete their work tasks with more efficiency. Another objective will be to make sure that employees complete their tasks by the stated deadlines. Two other objectives (which now total four) include having employees develop respect for themselves as well as others by being polite and extending various social courtesies and graces. While many people believe this could be a sort of morality training, it is basically training to help balance life at work and at home. The main issue that will be dealt with in meeting the goals or objectives is to try to stop workers from bringing home life drama into the workplace and to realize that there is a difference between