Interagency Disater Management of the US Midwest Floods of 1993 and Essay

Interagency Disater Management of the US Midwest Floods of 1993 and how it Might be Managed Different Today - Essay Example When the disaster subsided, meetings and hearings were convened, new policies were drafted, and the administration of Clinton assigned a task force. Key decision makers and legislators required documents, reports, assessments and development programs. A small portion of the population affected by the catastrophic flooding, whether they are on the floodplain or in the Beltway, hope for genuine reform, though, for different rationales: the flood-control strategy as well as the interagency flood management spends too much money, persuades behavior that worsens the predicament, and gives out some luscious boons to a privileged few, which consequently cultivated recurrent environmental crises (Sharp et al., 1997). As soon as the waters ebbed, interests in and attempts for reconstruction have receded as well. The gravely desired reforms in the system will, as the past has showed us, stayed mainly unmade. Afterward, with the following great flood, the same succession of hand-pressing, downpour of sympathy and financial assistance, and the consequent grief about costs, illogicalities, and injustices will be repeated. It is quite terrible. In fact, the solutions are not costly or even technologically complicated. They decided, though, to resolve a number of steamy issues, to deal with the execution rigidly and fairly, and, most importantly, more political moral fiber than is normally observed when flood-management decisions are usually made while the flooding devastates the lives of the people within its reach. In President Clinton’s State of the Union Address in 1994, he referred to the US Midwest Flood of 1993 as a‘500-year flood,’ which consequently led numerous people to think that such a catastrophe, could only occur once every 500 years. However, that is logically invalid. Such a hurricane could possibly happen the following spring. Our watercourses are speckled with â€Å"United States Geological Survey

Theories and Approaches of Policy Evaluation Paper Essay

Theories and Approaches of Policy Evaluation Paper - Essay Example Proper process evaluation helps to ensure that the complete quality of a program is attained by ensuring that it is liable to multiple stakeholders such as the administrators, personnel and community among others. This evaluation helps to identify the process involved in decision making, resourced required in implementation of the technology, the unexpected inconsistencies or prospects while running the program and the legal, social and economic conditions in which the program is run. Process evaluation is a continuous monitoring process that should not interfere with the primary work of an organization. Instead, such information can be used to make the necessary amendments for top performance, especially in the preparation of financial audits (Casey, 2002). Outcome-based evaluation is a vital step when planning a project since it helps in the identification of the possible results of the technology. Outcome-based evaluation is a vital step when developing a new program or analyzing an existing one. This is because the product of the analysis provides good knowledge of the object’s target group and how it will influence the people it serves (Fasten,

Impact of Job Satisfaction on Staff Turnover Literature review

Impact of Job Satisfaction on Staff Turnover - Literature review Example Nature of work is one of the primary factors which help in the development of job satisfaction among the employees. The interest level of the employees in the nature of job which is imposed by the employer guides the job satisfaction. If the employees face person role conflict, then the job satisfaction of the employees will never be high. Person role conflict deals with the fact that employees have to undertake tasks which does not suit them and they are either under qualified or overqualified for the job. The role play of an employee in the job should also provide opportunity for them to utilize their skills which they have learned over the years. The employees should be provided with autonomy in carrying out their jobs. Another important job related factor which helps in the building of the satisfaction is the clarity in the role to be played by the employees. If the employees are made clear regarding the roles which the organization expects from them in carrying out, then a signi ficant amount of satisfaction is generated within them. Proper training regarding the jobs also helps in the development of job satisfaction among the employees as they generate confidence within them through the training process. The employee participation has been one of the crucial aspect in modern times and effective participation of employees in the decision making process of the organization generates a feeling within the employees that they belong to the organization and are an important part of it. This feeling within them in turn imbibes satisfaction regarding their job (Lee, 1991, p.9). The work pressure which an employee has to experience generates the satisfaction level within them. Often employees are dissatisfied with their job owing to the excessive job pressure which they have to face (Spector, 1997, p.24). The above study does not incorporate the factor of place of work and the ambience of the workplace which also often can raise dissatisfaction among the employees in the workplace. Pay package: Pay package is the most important criteria which dominates the level of job satisfaction among the employees. Employees always look for a better pay package and the pay package often helps in balancing the other limitation which an employee may face in an organization. The inclusion of additional facilities in the pay package helps to raise the satisfaction level of the employees and the fulfillment of the demand for increment in the salary structure makes them satisfied in their job. Other than the salary which the employees receive, often employees

Theories and Approaches of Policy Evaluation Paper Essay

Theories and Approaches of Policy Evaluation Paper - Essay Example Proper process evaluation helps to ensure that the complete quality of a program is attained by ensuring that it is liable to multiple stakeholders such as the administrators, personnel and community among others. This evaluation helps to identify the process involved in decision making, resourced required in implementation of the technology, the unexpected inconsistencies or prospects while running the program and the legal, social and economic conditions in which the program is run. Process evaluation is a continuous monitoring process that should not interfere with the primary work of an organization. Instead, such information can be used to make the necessary amendments for top performance, especially in the preparation of financial audits (Casey, 2002). Outcome-based evaluation is a vital step when planning a project since it helps in the identification of the possible results of the technology. Outcome-based evaluation is a vital step when developing a new program or analyzing an existing one. This is because the product of the analysis provides good knowledge of the object’s target group and how it will influence the people it serves (Fasten,

Hinduism, buddhism and sikhism Essay Example | Topics and Well Written Essays - 1000 words

Hinduism, buddhism and sikhism - Essay Example his seven dimensions of religion.These are;practical or ritual,experiential or emotional,narrative or mythical,doctrinal or philosophical, legal or ethical,social or institutional and the material/artistic dimensions. In Hinduism, offerings and petitions are practices which enable them to connect to divine powers so as to solve their problems at the same time fulfilling their desires. Similarly, the Buddhist engage in detailed prayers which are intimate to show dedication to God. The Sikhs engage in a disciplined way of life of Naam Simran which is a way to meditate on God’s name. Hindus of all levels in society perform artistic dance, drama, music, poetry and representational arts and also practice cylindrical festivals which are sacred. Buddhas evoke Sangha to spread Buddha teachings after which the dharma students perform three bows or the three gates (body, tongue and mind). The palms of their hands, knees and forehead should touch the ground to signify earth, water, fire, air and space. The Buddha students bow during prayers with folded hands to signify Buddha of the past present and the future. The Sikhs live a disciplined life and no benefits are gained no matter where one is born since they all have to meditate (by reciting Gurbani and Kurtan which are music hymns) and give selfless service (by doing manual work at the Gurdwara e.g. cleaning dishes and floors) and wear Kesh, Kanga, Kaccha, Kara and Kirpan (Llewellyn 6-18). This refers to feelings and experience of various religions which incorporate stories of how their leaders experienced contact with either divine beings or energies. In Hinduism, Hindus assume to be concerned with spiritual enlightenment or the ultimate act of liberation (moksha). The urban elite and the rural Hindus dedicate their time and energy to obtain prosperity. In Buddhism, the most important emotional experience is meditation that enables emotional awareness and enlightenment. For instance, the Buddha connecting with the

DI-MS Technique for Analyzing Protein and Peptide Sequences

DI-MS Technique for Analyzing Protein and Peptide Sequences Food Industrial Application DI-MS technique has been widely applied in food industry as it is an easy and high-throughput tool for analyzing protein and peptide sequences, studying the components or structure in food, monitoring the contamination in food. FAB-MS In the study by Terzi, Boyot, Dorsselear, Luu and Trifilieff (1990), the amino acid sequence of a new 6.8 kDa proteolipid from beef heart was determined by employed FAB-MS. The study isolated and purified the 6.8 kDa proteolipid from an acidic methanol/chloroform extract of bovine cardiac muscle, and subsequently analyzed it with the application Cs atom beam of FAB-MS in 1-thioglycerol matrix. The result showed a protonated molecular ion [M+H]+ at m/z 6834.1 and indicated that it have about 60 residues. The 60 residues in the polypeptide were cleaved into three peptide fragments CN1, CN2 and CN3. To characterize these cleavage peptides from amino acid composition, the CN1 and CN2 were ionized using the FAB-MS that performed with Xe atom beam and 1-thioglycerol matrix while the CN3 which also dissolved in 1-thioglycerol was collided by Cs atom beam to produce sample ions. Table 1.0: Chemical mass of cleavage peptides Cleavage peptides Measured mass [M+H]+ [M+Na]+ CN1 1539.0 1560.9 CN2 2100.5 2121.8 CN3 3134.6 From the analysis of the cleavage peptides, the amino acid sequence and peptide fragments of the 6.8 kDa proteolipid were reported as: MLQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASS 1 CN1 13 14 CN2 31 32 CN3 AAPAHGHH 60 In addition, the FAB-MS technique was applied to determine the structure of the Lycium chinense Miller fruits (Gou-Qi-Zi) in combination with NMR and IR spectroscopy (Chung, Ali, Praveen, Yu, Kim, Ahmad, 2014). L. chinense fruit is a valuable tonic or food, hence there are many researches have been reported to display the properties the L.chinense fruit. For example, the anticancer, antibacterial and antioxidant properties (Lee et al., 2005; Wang, Chang, Inbaraj. Chen, 2010; Zhang et al., 2011) and the antihepatotoxic activity and chemical constituents (Chin et al., 2003; Kim et al., 1997). In the research, the four new compounds (i, ii, iii and iv) that isolated from L. chinense fruits were characterized using the FAB-MS (JMS-700) spectrometer. The antioxidant activity of the four compounds was further studied and it demonstrated that the activity of the compounds followed the order 1423. Table 2.0: Characterization of compound (i) to (iv) Mass Species m/z Detected species Suggestion Compound (i) [M+H]+ 817 C40H65O17 -aromatic acid glycosidic ester 283 [CH3(CH2)16COO]+ -steric acid was esterified with one phenolic group 267 [CH3(CH2)16CO]+ 414 [C15H26O13]+ -three arabinose units bind to one phenolic group 265 [C10H17O8]+ 133 [C5H9O4]+ Compound (ii) [M+H]+ 1165 C50H85O30 -susquiterpene glycoside ester 265 [C10H17O8]+ -few arabinose units bind to the sesquiterpene moiety 223 [C14H27CO]+ 133 [C5H8O5]+ Compound (iii) [M]+ 1309 C58H100O32 -hexaglycoside 341 [C12H21O11]+ -six hexose sugar units bind to each other -unsaturated fatty acid located at terminal position 335 [C21H39COO]+ 325 [C12H21O10]+ 319 [C12H39CO]+ 179 [C6H11O6]+ 163 [C6H11O5]+ Compound (iv) [M+H]+ 841 C31H52O26 -five arabinose units and one glucose unit 661 [C25H41O20]+ -five pentose sugar units bind to a hexose sugar 529 [C25H41O20-C5H8O4]+ 281 [C10H17O9]+ TOF-SIMS TOF-SIMS which widely applied in surface analysis is an important technique for monitoring the contamination in food as the usage of pesticides and fungicide in the agriculture practice will alter and compromise the food quality. The study used TOF-SIMS technique to characterize and compare three different groups of Seggianese olives which classified as untreated (UT), treated with insecticide (dimethoate) and fungicide (copper oxychloride) without washing (TU) and treated with insecticide and fungicide with washing with cold water (TW) (Focardi, et al., 2006). Before measuring the molecular masses of three different groups of olives, the mass calibration was done by using CH3+, C2H3+ and C3H5+ peaks as calibration compounds for positive ions C, CH and C2H peaks as calibration compounds for negative ions. The SIMS data proved the chemical treatments modify the surface composition of olive, resulting in higher intensity signals in TU compared with TW or UT olive spectra. Besides, the intensity of UT and TW olives showed a small variance between each other, demonstrating the washing process was no effective in removing of insecticides and fungicides that will stimulate the composition alterations of olives. Table 3.0: Intensity of few relevant peaks from three different olive samples Peaks Mass peak m/z Attribution Intensity TU olive TW olive UT olive Positive 31.018 CH3O+ 4.23 10-4 6.93 10-5 1.12 10-4 57.074 C4H9+ 1.18 10-2 5.92 10-3 5.08 10-3 73.051 C4H9O+ 7.83 10-4 3.34 10-4 3.08 10-4 147.082 C6H14NOP+ / C6H13NOS+ 2.42 10-4 7.37 10-5 2.93 10-5 Negative 15.994 O 1.13 10-4 2.30 10-3 7.20 10-3 17.002 OH 1.19 10-4 4.42 10-3 5.44 10-3 31.972 S 5.24 10-4 1.99 10-5 1.47 10-5 MALDI-TOF/TOF MS MALDI-MS is a widespread analytical tool for proteins, peptides and oligonucleotides as it offers high ion yields of the intact analyte samples, high sensitivity and accuracy (Lewis, Wei, Siuzdak, 2000). In year 2012, a research about the peptide of peanut hydrolysate has the properties of umami taste had reported by Su, Cui, Zheng, Yang, Ren Zhao. Umami taste is known as the fifth basic taste and it usually described as savory or MSG-like taste. In the study, two novel umami and umami-enhancing peptides were isolated from peanut hydrolysate, purified using chromatography and identified by MALDI-TOF/TOF MS. The analysis of peptides was performed by MALDI-MS equipped with 337nm of UV nitrogen laser and matrix solution as sinapic acid saturated in 0.1% trifluoroacetic acid and acetonitrile. The MALDI-TOF/TOF MS was used to sequence the two novel peptides that termed as P3 and P4 as they produce umami taste. It found that the molecular mass of P3 and P4 was 1091.419 Da and 965.595 Da respectively and the amino sequence of P3 is EGSEAPDGSSR while P4 is SSRDEQSR. Bibliography Chung, I. M., Ali, M., Praveen, N., Yu, B. R., Kim, S. H., Ahmad, A. (2014). New polyglucopyranosyl and polyarabinopyranosyl of fatty acid derivatives from the fruits of Lycium chinense and its antioxidant activity. Food Chemistry, 435-443. Focardi, S., Ristori, S., Mazzuoli, S., Tognazzi, A., Leach-Scampavia, D., Castner, D. G., et al. (2006). ToF-SIMS and PCA studies of Seggianese olives and olive oil. Colloids and Surfaces, 225-232. Lewis, J. K., Wei, J., Siuzdak, G. (2000). Matrix-assited laser desorption/iomization mass spectrometry in peptide and protein analysis. Chichester: John Wiley Sons Ltd. Su, G., Cui, C., Zheng, L., Yang, B., Ren, J., Zhao, M. (2012). Isolation and identification of two novel umami and umami-enhancing peptides from peanut hydrolysate by consecutive chromatography and MALDI-TOF/TOF MS. Food Chemistry, 479-485. Terzi, E., Boyot, P., Dorsselear, A. V., Luu, B., Trifilieff, E. (1990). Isolation and amino acid sequence of a novel 6.8-kDa mitochondrial proteolipid from beef heart. FABS Letters, 122-126. Conclusion In food industry, the analysis of protein and peptide can be performed well by using MALDI-MS and FAB-MS while the application of SIMS is mostly used for detecting the surface of contaminated food. Besides, the structure of the components in foods can also be identified by using the FAB-MS combined with NMR and IR spectroscopies.

Silence in a Classroom :: Learning Teach Teachers Papers

Silence in a Classroom How can silence be put to use in a feminist classroom? What are the positive ways to cultivate silence, ways which empower, rather than shut down? Audre Lorde has been widely quoted on the negative impacts of silence on women. She uses the term "silence" as an active verb; those with power have historically silenced others.But I am interested in the other implications for silence, namely, using silence as a tool:for discovery, creation, and real critical thinking.Our culture is afraid of silence.We bombard ourselves with cell phones, television and radio. Often the assumption is that if someone is not talking, it must be a "bad" thing.As teachers, we replicate this model in our classrooms.We feel that students must really be getting something out of our classes when they talk about what they are learning.But does talking always insure that a student has really processed the material and made it her own? Or is talking in class often another form of performing for the teacher? Particularly in a writing class, where students are practicing putting words down on the page, cultivating a silent space seems imperative.My belief is that the more students are encouraged to write rather than talk in the composition classroom, the more they will trust their stance as authors of their own pieces.Silence can be an opening into the untapped places where deep, explorative writing is created.Peter Elbow writes about "felt sense," the way we can feel whether or not our intentions are being expressed in our writing by "listening" to our bodies: The foundation of verbal meaning often lies in the silence of what is felt nonverbally and bodily.When writing goes well, it is often because we periodically pause and say, 'Is this what I mean to be saying?'It's amazing that we can answer that question:that we can tell whether a given set of words corresponds to an intention.The source of the answer is the feelings and the body-consulted in silence.When writing goes badly, it is often because we don't make these pauses for quiet consultations with felt sense. (Everyone Can Write 176) Many of our students are just learning to "trust" themselves as writers.Most haven't had the opportunity in high school to explore what writing can do for their thinking; they have been taught that "writing" is a product produced for a teacher.Student-centered pedagogy seeks to de-center teacher authority, and has moved away from traditional methods such as the lecture format to more group discussion.